PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC7430_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 317aa    MW: 35801.8 Da    PI: 7.0166
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC7430_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1591.9e-49141391128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrF Ptdeel+veyL++k++g++++l + i+e+d+yk++ w Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk + + +g+ 
  RrC7430_p1  14 LPPGFRFYPTDEELMVEYLCRKAAGHDFSL-QLIAEIDLYKFDAWVLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVIST-EGRR 110
                 79***************************9.89***************8777899**********************************99999.9999 PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kk Lvfy g+apkg+kt+W+mheyrl
  RrC7430_p1 111 VGIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-6310162IPR003441NAC domain
PROSITE profilePS5100558.16214162IPR003441NAC domain
PfamPF023653.0E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGIQEVDPLA QLSLPPGFRF YPTDEELMVE YLCRKAAGHD FSLQLIAEID LYKFDAWVLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVISTEGRR VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLI EPSRRYGSTK LDDWVLCRIY KKQSSAQKQV YSNLMTSVRE  180
YSNDGSSTSS SSHQYNDVLE SLHEIDNRSL GFAAGSSNAP PHHSQRTSLT EQKTGFLNLA  240
REPSFDWPSY GGHTSVPQLT PSHNVPSFCY GEGSGYFQSV KTNEEDDRNQ QQAEGFSVDP  300
VNGFPNSDQQ HDAFGFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-11711687174NAC domain-containing protein 19
3swm_B1e-11711687174NAC domain-containing protein 19
3swm_C1e-11711687174NAC domain-containing protein 19
3swm_D1e-11711687174NAC domain-containing protein 19
3swp_A1e-11711687174NAC domain-containing protein 19
3swp_B1e-11711687174NAC domain-containing protein 19
3swp_C1e-11711687174NAC domain-containing protein 19
3swp_D1e-11711687174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013644954.10.0PREDICTED: NAC domain-containing protein 55-like
SwissprotQ9LDY80.0NAC55_ARATH; NAC domain-containing protein 55
TrEMBLA0A0D3ADF10.0A0A0D3ADF1_BRAOL; Uncharacterized protein
STRINGBra021113.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.10.0NAC domain containing protein 3